Sale!

weprideourselvesongivingeachcustomerweserveasiftheywerefamilymemberswelovehelpingpeoplefindtheolmstiv2paintmatchedspoilersidefins20152020subaruwrxstiolm0.jpg

OLM STI V2 Paint Matched Spoiler Side Fins 2015-2020 Subaru WRX & STI OLM

Name: We pride ourselves on giving each customer we serve as if they were family members. We love helping people find the OLM STI V2 Paint Matched Spoiler Side Fins 2015-2020 Subaru WRX & STI OLM
SKU: mode_6550600286304
Price: 42.38 USD
Availability: InStock

Original price was: $ 84,76.Current price is: $ 42,38.

Color

Clear

SKU: mode_6550600286304 Category: Exterior Spoilers and Wings Tags: Advertise-Google: Stop, Backorder: Yes, Category:Exterior Spoilers and Wings, FT: NO, leasable, Menu: Exterior, pre-order, STI_2015-2021, Supplier: Rallysport, Vehicle Make_Subaru, Vehicle Model_STi, Vehicle Model_WRX, vendor_OLM, WRX_2015-2021

HIGHLIGHTS
Paint Matched
Super easy install
Comes with everything you need to install
GIVE YOUR SUBIE’S REAR END A WHOLE NEW AGGRESSIVE CUSTOM LOOK
There are a few various enhancements available for the stock 2015-2020 Subaru STI spoiler. For anyone rocking it, they can add these side fin winglets as well.

Just clean the surface of your wing and use the supplied double sided adhesive to mount.

EASY INSTALLATION FOR BIG STREET CRED
Make the rear end of either your 2015-2020 Subaru WRX or STI better looking and more aggressive with the OLM STI V2 Paint Matched Spoiler Side Fins! These OLM STI V2 Paint Matched Spoiler Side Fins are a huge upgrade for your WRX or STI. The bang for the buck is high as this piece can really transform your rear end. Mounts easily with supplied hardware. Keeps it secure at high speeds.

3M ADHESIVE INFORMATION
Temperature: Ideal application temperature range is 70°F to 100°F (21°C to 38°C). Pressure sensitive adhesives use viscous flow to achieve substrate contact area.

Time: After application, the bond strength will increase as the adhesive flows onto the surface (also referred to as “wet out”). At room temperature approximately 50% of ultimate bond strength will be achieved after 20 minutes, 90% after 24 hours and 100% after 72 hours. This ow is faster at higher temperatures and slower at lower temperatures.

Color	Dark Grey Metallic, Lightning Red, Crystal Black Silica, Galaxy Blue Pearl, Icy Silver Metallic, Crystal White Pearl, Pure Red, Lapis Blue Pearl, WR Blue Pearl, Matte Black

Fast Shipping & Professional Packing

Due to our longstanding partnership with UPS FedEx DHL, and other leading international carriers, we are able to provide a range of shipping options. Our warehouse personnel is highly-skilled and will pack your products according to our precise and accurate specifications. Your items will undergo an exhaustive inspection and adequately secured before being delivered. We ship to thousands of customers each day from multiple countries. This is a testament to our determination to become the largest online retailer worldwide. Both Europe and the USA have warehouses and distribution centers.

Note: Orders that contain more than one item will be assigned a processing date depending on the item.

Prior to shipping before shipping, we'll conduct a thorough inspection of the items you've ordered. The majority of orders are shipped within 48-hours. The estimated delivery time is between 3 and 7 days.

Returns

We are not able to manage the stock in our warehouse and factory. The actual levels of stock can change at any time. Be aware that it's possible for your order to be out of stock after you have made the order.

Our policy lasts thirty days. If you don't receive the product within 30 days, we're not able to provide the option of a refund or exchange.

The item cannot be in use and must be in its original condition. It must also be in the original packaging.

OLM STI V2 Paint Matched Spoiler Side Fins 2015-2020 Subaru WRX & STI OLM

Related products

Login